Lineage for d1ixsa_ (1ixs A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534233Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 534234Superfamily a.5.1: DNA helicase RuvA subunit, C-terminal domain [46929] (1 family) (S)
    possibly related to UBA-like domains
  5. 534235Family a.5.1.1: DNA helicase RuvA subunit, C-terminal domain [46930] (1 protein)
  6. 534236Protein DNA helicase RuvA subunit, C-terminal domain [46931] (3 species)
    tetramer; binds Holliday junction
  7. 534254Species Thermus thermophilus [TaxId:274] [81702] (2 PDB entries)
  8. 534255Domain d1ixsa_: 1ixs A: [76932]
    Other proteins in same PDB: d1ixsb1, d1ixsb2
    complexed with anp

Details for d1ixsa_

PDB Entry: 1ixs (more details), 3.2 Å

PDB Description: Structure of RuvB complexed with RuvA domain III

SCOP Domain Sequences for d1ixsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixsa_ a.5.1.1 (A:) DNA helicase RuvA subunit, C-terminal domain {Thermus thermophilus}
eseaaeeavmalaalgfkeaqaravvldllaqnpkaraqdlikealkrlr

SCOP Domain Coordinates for d1ixsa_:

Click to download the PDB-style file with coordinates for d1ixsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ixsa_: