Class a: All alpha proteins [46456] (290 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.1: DNA helicase RuvA subunit, C-terminal domain [46929] (1 family) possibly related to UBA-like domains |
Family a.5.1.1: DNA helicase RuvA subunit, C-terminal domain [46930] (1 protein) |
Protein DNA helicase RuvA subunit, C-terminal domain [46931] (3 species) tetramer; binds Holliday junction |
Species Thermus thermophilus [TaxId:274] [81702] (2 PDB entries) |
Domain d1ixsa_: 1ixs A: [76932] Other proteins in same PDB: d1ixsb1, d1ixsb2 complexed with anp |
PDB Entry: 1ixs (more details), 3.2 Å
SCOPe Domain Sequences for d1ixsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixsa_ a.5.1.1 (A:) DNA helicase RuvA subunit, C-terminal domain {Thermus thermophilus [TaxId: 274]} eseaaeeavmalaalgfkeaqaravvldllaqnpkaraqdlikealkrlr
Timeline for d1ixsa_: