Lineage for d1ixsa_ (1ixs A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696010Superfamily a.5.1: DNA helicase RuvA subunit, C-terminal domain [46929] (1 family) (S)
    possibly related to UBA-like domains
  5. 2696011Family a.5.1.1: DNA helicase RuvA subunit, C-terminal domain [46930] (1 protein)
  6. 2696012Protein DNA helicase RuvA subunit, C-terminal domain [46931] (3 species)
    tetramer; binds Holliday junction
  7. 2696030Species Thermus thermophilus [TaxId:274] [81702] (2 PDB entries)
  8. 2696031Domain d1ixsa_: 1ixs A: [76932]
    Other proteins in same PDB: d1ixsb1, d1ixsb2
    complexed with anp

Details for d1ixsa_

PDB Entry: 1ixs (more details), 3.2 Å

PDB Description: Structure of RuvB complexed with RuvA domain III
PDB Compounds: (A:) holliday junction DNA helicase ruva

SCOPe Domain Sequences for d1ixsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixsa_ a.5.1.1 (A:) DNA helicase RuvA subunit, C-terminal domain {Thermus thermophilus [TaxId: 274]}
eseaaeeavmalaalgfkeaqaravvldllaqnpkaraqdlikealkrlr

SCOPe Domain Coordinates for d1ixsa_:

Click to download the PDB-style file with coordinates for d1ixsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ixsa_: