SCOP 1.65: Domain d1ixrc2: 1ixr C:5-242

Lineage for d1ixrc2 (1ixr C:5-242)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (15 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Holliday junction helicase RuvB [52713] (2 species)
   contains "winged helix" DNA-binding domain after the family specific domains

7. Species Thermus thermophilus [TaxId:274] [52714] (3 PDB entries)

8. Domain d1ixrc2: 1ixr C:5-242 [76931]
   Other proteins in same PDB: d1ixra1, d1ixra2, d1ixrb1, d1ixrb2, d1ixrb3, d1ixrc1
   complexed with anp; mutant

Details for d1ixrc2

PDB Entry: 1ixr, 3.3 Å

PDB Description: ruva-ruvb complex

SCOP Domain Sequences for d1ixrc2:

Sequence; same for both SEQRES and ATOM records:

>d1ixrc2 c.37.1.20 (C:5-242) Holliday junction helicase RuvB {Thermus thermophilus}
alrpktldeyigqerlkqklrvyleaakarkeplehlllfgppglgkttlahviahelgv
nlrvtsgpaiekpgdlaailansleegdilfideihrlsrqaeehlypamedfvmdivig
qgpaartirlelprftligattrpglitapllsrfgivehleyytpeelaqgvmrdarll
gvriteeaaleigrrsrgtmrvakrlfrrvrdfaqvageevitreralealaalglde

Timeline for d1ixrc2:

• d1ixrc2 first appeared in SCOP 1.63
  
• d1ixrc2 appears in SCOP 1.67
  
• d1ixrc2 appears in the current release, SCOPe 2.08