Lineage for d1ixrc2 (1ixr C:5-242)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870969Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2871097Protein Holliday junction helicase RuvB [52713] (2 species)
    contains "winged helix" DNA-binding domain after the family specific domains
  7. 2871105Species Thermus thermophilus [TaxId:274] [52714] (3 PDB entries)
  8. 2871109Domain d1ixrc2: 1ixr C:5-242 [76931]
    Other proteins in same PDB: d1ixra1, d1ixra2, d1ixrb1, d1ixrb2, d1ixrb3, d1ixrc1
    complexed with anp

Details for d1ixrc2

PDB Entry: 1ixr (more details), 3.3 Å

PDB Description: ruva-ruvb complex
PDB Compounds: (C:) ruvb

SCOPe Domain Sequences for d1ixrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixrc2 c.37.1.20 (C:5-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}
alrpktldeyigqerlkqklrvyleaakarkeplehlllfgppglgkttlahviahelgv
nlrvtsgpaiekpgdlaailansleegdilfideihrlsrqaeehlypamedfvmdivig
qgpaartirlelprftligattrpglitapllsrfgivehleyytpeelaqgvmrdarll
gvriteeaaleigrrsrgtmrvakrlfrrvrdfaqvageevitreralealaalglde

SCOPe Domain Coordinates for d1ixrc2:

Click to download the PDB-style file with coordinates for d1ixrc2.
(The format of our PDB-style files is described here.)

Timeline for d1ixrc2: