SCOPe 2.08: Domain d1ixrc1: 1ixr C:243-312

Lineage for d1ixrc1 (1ixr C:243-312)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins)
   follows the extended AAA-ATPase domain

6. Protein Holliday junction helicase RuvB [46820] (2 species)

7. Species Thermus thermophilus [TaxId:274] [46821] (3 PDB entries)

8. Domain d1ixrc1: 1ixr C:243-312 [76930]
   Other proteins in same PDB: d1ixra1, d1ixra2, d1ixrb1, d1ixrb2, d1ixrb3, d1ixrc2
   complexed with anp

Details for d1ixrc1

PDB Entry: 1ixr, 3.3 Å

PDB Description: ruva-ruvb complex

PDB Compounds: (C:) ruvb

SCOPe Domain Sequences for d1ixrc1:

Sequence; same for both SEQRES and ATOM records:

>d1ixrc1 a.4.5.11 (C:243-312) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}
lglekrdreilevlilrfgggpvglatlatalsedpgtleevhepylirqgllkrtprgr
vatelarrhl

Timeline for d1ixrc1:

• d1ixrc1 first appeared in SCOP 1.63
  
• d1ixrc1 appears in SCOPe 2.07