Lineage for d1ixra2 (1ixr A:1-62)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789318Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
    barrel, closed; n=5, S=10
    automatically mapped to Pfam PF01330
  6. 2789319Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species)
    tetramer; binds Holliday junction
  7. 2789339Species Thermus thermophilus [TaxId:274] [82098] (1 PDB entry)
  8. 2789340Domain d1ixra2: 1ixr A:1-62 [76926]
    Other proteins in same PDB: d1ixra1, d1ixrb1, d1ixrb2, d1ixrc1, d1ixrc2
    complexed with anp

Details for d1ixra2

PDB Entry: 1ixr (more details), 3.3 Å

PDB Description: ruva-ruvb complex
PDB Compounds: (A:) holliday junction DNA helicase ruva

SCOPe Domain Sequences for d1ixra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixra2 b.40.4.2 (A:1-62) DNA helicase RuvA subunit, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mirylrglvlkkeaggfvllaggvgfflqaptpflqaleegkevgvhthlllkeeglsly
gf

SCOPe Domain Coordinates for d1ixra2:

Click to download the PDB-style file with coordinates for d1ixra2.
(The format of our PDB-style files is described here.)

Timeline for d1ixra2: