Lineage for d1ixnc_ (1ixn C:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 238181Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (1 family) (S)
  5. 238182Family c.1.24.1: Pyridoxine 5'-phosphate synthase [63893] (1 protein)
  6. 238183Protein Pyridoxine 5'-phosphate synthase [63894] (1 species)
  7. 238184Species Escherichia coli [TaxId:562] [63895] (6 PDB entries)
  8. 238195Domain d1ixnc_: 1ixn C: [76911]

Details for d1ixnc_

PDB Entry: 1ixn (more details), 2.3 Å

PDB Description: Enzyme-Substrate Complex of Pyridoxine 5'-Phosphate Synthase

SCOP Domain Sequences for d1ixnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixnc_ c.1.24.1 (C:) Pyridoxine 5'-phosphate synthase {Escherichia coli}
aelllgvnidhiatlrnargtaypdpvqaafiaeqagadgitvhlredrrhitdrdvril
rqtldtrmnlemavteemlaiavetkphfcclvpekrqevtteggldvagqrdkmrdack
rladagiqvslfidadeeqikaaaevgapfieihtgcyadaktdaeqaqelariakaatf
aaslglkvnaghgltyhnvkaiaaipemhelnighaiigravmtglkdavaemkrlmlea
rg

SCOP Domain Coordinates for d1ixnc_:

Click to download the PDB-style file with coordinates for d1ixnc_.
(The format of our PDB-style files is described here.)

Timeline for d1ixnc_: