Lineage for d1ixna_ (1ixn A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840720Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) (S)
  5. 2840721Family c.1.24.1: Pyridoxine 5'-phosphate synthase [63893] (2 proteins)
    automatically mapped to Pfam PF03740
  6. 2840722Protein Pyridoxine 5'-phosphate synthase [63894] (1 species)
  7. 2840723Species Escherichia coli [TaxId:562] [63895] (7 PDB entries)
  8. 2840732Domain d1ixna_: 1ixn A: [76909]
    complexed with dxp, g3p

Details for d1ixna_

PDB Entry: 1ixn (more details), 2.3 Å

PDB Description: Enzyme-Substrate Complex of Pyridoxine 5'-Phosphate Synthase
PDB Compounds: (A:) pyridoxine 5'-phosphate synthase

SCOPe Domain Sequences for d1ixna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixna_ c.1.24.1 (A:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]}
aelllgvnidhiatlrnargtaypdpvqaafiaeqagadgitvhlredrrhitdrdvril
rqtldtrmnlemavteemlaiavetkphfcclvpekrqevtteggldvagqrdkmrdack
rladagiqvslfidadeeqikaaaevgapfieihtgcyadaktdaeqaqelariakaatf
aaslglkvnaghgltyhnvkaiaaipemhelnighaiigravmtglkdavaemkrlmlea
rg

SCOPe Domain Coordinates for d1ixna_:

Click to download the PDB-style file with coordinates for d1ixna_.
(The format of our PDB-style files is described here.)

Timeline for d1ixna_: