Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) |
Family c.1.24.1: Pyridoxine 5'-phosphate synthase [63893] (2 proteins) automatically mapped to Pfam PF03740 |
Protein Pyridoxine 5'-phosphate synthase [63894] (1 species) |
Species Escherichia coli [TaxId:562] [63895] (7 PDB entries) |
Domain d1ixna_: 1ixn A: [76909] complexed with dxp, g3p |
PDB Entry: 1ixn (more details), 2.3 Å
SCOPe Domain Sequences for d1ixna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixna_ c.1.24.1 (A:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]} aelllgvnidhiatlrnargtaypdpvqaafiaeqagadgitvhlredrrhitdrdvril rqtldtrmnlemavteemlaiavetkphfcclvpekrqevtteggldvagqrdkmrdack rladagiqvslfidadeeqikaaaevgapfieihtgcyadaktdaeqaqelariakaatf aaslglkvnaghgltyhnvkaiaaipemhelnighaiigravmtglkdavaemkrlmlea rg
Timeline for d1ixna_: