Lineage for d1ix9b2 (1ix9 B:91-205)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903583Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1903584Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1903585Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 1903711Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 1903736Species Escherichia coli [TaxId:562] [54722] (12 PDB entries)
  8. 1903738Domain d1ix9b2: 1ix9 B:91-205 [76902]
    Other proteins in same PDB: d1ix9a1, d1ix9b1
    complexed with mn; mutant

Details for d1ix9b2

PDB Entry: 1ix9 (more details), 0.9 Å

PDB Description: crystal structure of the e. coli manganase(iii) superoxide dismutase mutant y174f at 0.90 angstroms resolution.
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1ix9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ix9b2 d.44.1.1 (B:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayflkfqnrrpdyikefwnvvnwdeaaarfaakk

SCOPe Domain Coordinates for d1ix9b2:

Click to download the PDB-style file with coordinates for d1ix9b2.
(The format of our PDB-style files is described here.)

Timeline for d1ix9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ix9b1