Lineage for d1ix9b2 (1ix9 B:91-205)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256440Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 256441Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 256442Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 256518Protein Mn superoxide dismutase (MnSOD) [54721] (6 species)
  7. 256529Species Escherichia coli [TaxId:562] [54722] (10 PDB entries)
  8. 256531Domain d1ix9b2: 1ix9 B:91-205 [76902]
    Other proteins in same PDB: d1ix9a1, d1ix9b1
    complexed with mh3; mutant

Details for d1ix9b2

PDB Entry: 1ix9 (more details), 0.9 Å

PDB Description: crystal structure of the e. coli manganase(iii) superoxide dismutase mutant y174f at 0.90 angstroms resolution.

SCOP Domain Sequences for d1ix9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ix9b2 d.44.1.1 (B:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayflkfqnrrpdyikefwnvvnwdeaaarfaakk

SCOP Domain Coordinates for d1ix9b2:

Click to download the PDB-style file with coordinates for d1ix9b2.
(The format of our PDB-style files is described here.)

Timeline for d1ix9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ix9b1