SCOPe 2.05: Domain d1iwya_: 1iwy A:

Lineage for d1iwya_ (1iwy A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Human (Homo sapiens) [TaxId:9606] [53969] (201 PDB entries)
   Uniprot P00695

8. Domain d1iwya_: 1iwy A: [76895]
   complexed with cl

Details for d1iwya_

PDB Entry: 1iwy, 1.4 Å

PDB Description: Crystal Structure Analysis of Human lysozyme at 170K.

PDB Compounds: (A:) Lysozyme C

SCOPe Domain Sequences for d1iwya_:

Sequence; same for both SEQRES and ATOM records:

>d1iwya_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

Timeline for d1iwya_:

• d1iwya_ first appeared in SCOP 1.63
  
• d1iwya_ appears in SCOPe 2.04
  
• d1iwya_ appears in SCOPe 2.06
  
• d1iwya_ appears in the current release, SCOPe 2.08