Lineage for d1iwpg_ (1iwp G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312626Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2312634Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) (S)
    contains irregular N-terminal subdomain
    automatically mapped to Pfam PF02287
  5. 2312635Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (2 proteins)
  6. 2312636Protein Diol dehydratase, gamma subunit [47150] (2 species)
  7. 2312654Species Klebsiella pneumoniae [TaxId:573] [81728] (2 PDB entries)
  8. 2312655Domain d1iwpg_: 1iwp G: [76887]
    Other proteins in same PDB: d1iwpa_, d1iwpb_, d1iwpe_, d1iwpl_
    complexed with b12, k, pgo

Details for d1iwpg_

PDB Entry: 1iwp (more details), 2.1 Å

PDB Description: Glycerol Dehydratase-cyanocobalamin Complex of Klebsiella pneumoniae
PDB Compounds: (G:) Glycerol Dehydratase Gamma subunit

SCOPe Domain Sequences for d1iwpg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwpg_ a.23.2.1 (G:) Diol dehydratase, gamma subunit {Klebsiella pneumoniae [TaxId: 573]}
ktmrvqdyplatrcpehiltptgkpltditlekvlsgevgpqdvrisrqtleyqaqiaeq
mqrhavarnfrraaeliaipderilaiynalrpfrssqaellaiadelehtwhatvnaaf
vresaevyqqrhklrkgs

SCOPe Domain Coordinates for d1iwpg_:

Click to download the PDB-style file with coordinates for d1iwpg_.
(The format of our PDB-style files is described here.)

Timeline for d1iwpg_: