![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
![]() | Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) ![]() contains irregular N-terminal subdomain automatically mapped to Pfam PF02287 |
![]() | Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (2 proteins) |
![]() | Protein Diol dehydratase, gamma subunit [47150] (2 species) |
![]() | Species Klebsiella pneumoniae [TaxId:573] [81728] (2 PDB entries) |
![]() | Domain d1iwpg_: 1iwp G: [76887] Other proteins in same PDB: d1iwpa_, d1iwpb_, d1iwpe_, d1iwpl_ complexed with b12, k, pgo |
PDB Entry: 1iwp (more details), 2.1 Å
SCOPe Domain Sequences for d1iwpg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iwpg_ a.23.2.1 (G:) Diol dehydratase, gamma subunit {Klebsiella pneumoniae [TaxId: 573]} ktmrvqdyplatrcpehiltptgkpltditlekvlsgevgpqdvrisrqtleyqaqiaeq mqrhavarnfrraaeliaipderilaiynalrpfrssqaellaiadelehtwhatvnaaf vresaevyqqrhklrkgs
Timeline for d1iwpg_: