![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.3: B12-dependend dehydatases associated subunit [52968] (2 families) ![]() |
![]() | Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein) contains additional structures in the C-terminal extension |
![]() | Protein Diol dehydratase, beta subunit [52970] (2 species) |
![]() | Species Klebsiella pneumoniae [TaxId:573] [82432] (1 PDB entry) |
![]() | Domain d1iwpe_: 1iwp E: [76886] Other proteins in same PDB: d1iwpa_, d1iwpg_, d1iwpl_, d1iwpm_ complexed with b12, k, pgo |
PDB Entry: 1iwp (more details), 2.1 Å
SCOP Domain Sequences for d1iwpe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iwpe_ c.51.3.1 (E:) Diol dehydratase, beta subunit {Klebsiella pneumoniae} ftlktreggvasaderadevvigvgpafdkhqhhtlidmphgailkeliagveeeglhar vvrilrtsdvsfmawdaanlsgsgigigiqskgttvihqrdllplsnlelfsqaplltle tyrqigknaaryarkespspvpvvndqmvrpkfmakaalfhiketkhvvqdaepvtlhid lvre
Timeline for d1iwpe_: