Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (22 species) |
Species Horse (Equus caballus) [TaxId:9796] [46488] (14 PDB entries) |
Domain d1iwha_: 1iwh A: [76882] Other proteins in same PDB: d1iwhb_ complexed with cmo, hem, pem |
PDB Entry: 1iwh (more details), 1.55 Å
SCOPe Domain Sequences for d1iwha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iwha_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]} vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk kvgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpa vhasldkflssvstvltskyr
Timeline for d1iwha_: