Lineage for d1iwha_ (1iwh A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 530658Protein Hemoglobin, alpha-chain [46486] (19 species)
  7. 530709Species Horse (Equus caballus) [TaxId:9796] [46488] (5 PDB entries)
  8. 530710Domain d1iwha_: 1iwh A: [76882]
    Other proteins in same PDB: d1iwhb_
    complexed with cmo, hem, pem

Details for d1iwha_

PDB Entry: 1iwh (more details), 1.55 Å

PDB Description: Crystal Structure of Horse Carbonmonoxyhemoglobin-Bezafibrate Complex at 1.55A Resolution: A Novel Allosteric Binding Site in R-State Hemoglobin

SCOP Domain Sequences for d1iwha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwha_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus)}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOP Domain Coordinates for d1iwha_:

Click to download the PDB-style file with coordinates for d1iwha_.
(The format of our PDB-style files is described here.)

Timeline for d1iwha_: