SCOP 1.69: Domain d1iwha_: 1iwh A:

Lineage for d1iwha_ (1iwh A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (22 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (18 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46488] (5 PDB entries)

8. Domain d1iwha_: 1iwh A: [76882]
   Other proteins in same PDB: d1iwhb_

Details for d1iwha_

PDB Entry: 1iwh, 1.55 Å

PDB Description: Crystal Structure of Horse Carbonmonoxyhemoglobin-Bezafibrate Complex at 1.55A Resolution: A Novel Allosteric Binding Site in R-State Hemoglobin

SCOP Domain Sequences for d1iwha_:

Sequence; same for both SEQRES and ATOM records:

>d1iwha_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus)}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

Timeline for d1iwha_:

• d1iwha_ first appeared in SCOP 1.63
  
• d1iwha_ appears in SCOP 1.67
  
• d1iwha_ appears in SCOP 1.71
  
• d1iwha_ appears in the current release, SCOPe 2.08