Lineage for d1iw8e_ (1iw8 E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006107Fold a.111: Acid phosphatase/Vanadium-dependent haloperoxidase [48316] (1 superfamily)
    multihelical; core: 5-helical bundle; binds cofactor at the beginning of third helix
  4. 2006108Superfamily a.111.1: Acid phosphatase/Vanadium-dependent haloperoxidase [48317] (4 families) (S)
  5. 2006109Family a.111.1.1: Type 2 phosphatidic acid phosphatase, PAP2 [48318] (1 protein)
  6. 2006110Protein Bacterial acid phosphatase [48319] (1 species)
  7. 2006111Species Escherichia blattae [TaxId:563] [48320] (3 PDB entries)
  8. 2006120Domain d1iw8e_: 1iw8 E: [76870]
    complexed with so4; mutant

Details for d1iw8e_

PDB Entry: 1iw8 (more details), 2.5 Å

PDB Description: crystal structure of a mutant of acid phosphatase from escherichia blattae (g74d/i153t)
PDB Compounds: (E:) acid phosphatase

SCOPe Domain Sequences for d1iw8e_:

Sequence, based on SEQRES records: (download)

>d1iw8e_ a.111.1.1 (E:) Bacterial acid phosphatase {Escherichia blattae [TaxId: 563]}
gndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaae
danlssgdvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfaf
ygvstcntteqdklskngsypsghtstgwatalvlaeinpqrqneilkrgyelgqsrvic
gyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaq

Sequence, based on observed residues (ATOM records): (download)

>d1iw8e_ a.111.1.1 (E:) Bacterial acid phosphatase {Escherichia blattae [TaxId: 563]}
gndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaae
danlssgdvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfaf
ygvstcnskngsypsghtstgwatalvlaeinpqrqneilkrgyelgqsrvicgyhwqsd
vdaarvvgsavvatlhtnpafqqqlqkakaefaq

SCOPe Domain Coordinates for d1iw8e_:

Click to download the PDB-style file with coordinates for d1iw8e_.
(The format of our PDB-style files is described here.)

Timeline for d1iw8e_: