SCOPe 2.06: Domain d1iw8b_: 1iw8 B:

Lineage for d1iw8b_ (1iw8 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.111: Acid phosphatase/Vanadium-dependent haloperoxidase [48316] (1 superfamily)
   multihelical; core: 5-helical bundle; binds cofactor at the beginning of third helix

4. Superfamily a.111.1: Acid phosphatase/Vanadium-dependent haloperoxidase [48317] (4 families)

5. Family a.111.1.1: Type 2 phosphatidic acid phosphatase, PAP2 [48318] (1 protein)

6. Protein Bacterial acid phosphatase [48319] (1 species)

7. Species Escherichia blattae [TaxId:563] [48320] (3 PDB entries)

8. Domain d1iw8b_: 1iw8 B: [76867]
   complexed with so4; mutant

Details for d1iw8b_

PDB Entry: 1iw8, 2.5 Å

PDB Description: crystal structure of a mutant of acid phosphatase from escherichia blattae (g74d/i153t)

PDB Compounds: (B:) acid phosphatase

SCOPe Domain Sequences for d1iw8b_:

Sequence, based on SEQRES records:

>d1iw8b_ a.111.1.1 (B:) Bacterial acid phosphatase {Escherichia blattae [TaxId: 563]}
tgndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaa
edanlssgdvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfa
fygvstcntteqdklskngsypsghtstgwatalvlaeinpqrqneilkrgyelgqsrvi
cgyhwqsdvdaarvvgsavvatlhtnpafqqqlqkakaefaqhqk

Sequence, based on observed residues (ATOM records):

>d1iw8b_ a.111.1.1 (B:) Bacterial acid phosphatase {Escherichia blattae [TaxId: 563]}
tgndtttkpdlyylknseainslallppppavgsiaflndqamyeqgrllrntergklaa
edanlssgdvanafsgafgspitekdapalhklltnmiedagdlatrsakdhymrirpfa
fygvstcntskngsypsghtstgwatalvlaeinpqrqneilkrgyelgqsrvicgyhwq
sdvdaarvvgsavvatlhtnpafqqqlqkakaefaqhqk

Timeline for d1iw8b_:

• d1iw8b_ first appeared in SCOP 1.63
  
• d1iw8b_ appears in SCOPe 2.05
  
• d1iw8b_ appears in SCOPe 2.07
  
• d1iw8b_ appears in the current release, SCOPe 2.08