Lineage for d1ivza1 (1ivz A:8-126)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2198417Superfamily d.58.41: SEA domain [82671] (1 family) (S)
    automatically mapped to Pfam PF01390
  5. 2198418Family d.58.41.1: SEA domain [82672] (1 protein)
  6. 2198419Protein SEA domain from the hypothetical protein homologous to mucin 16 [82673] (1 species)
  7. 2198420Species Mouse (Mus musculus) [TaxId:10090] [82674] (1 PDB entry)
  8. 2198421Domain d1ivza1: 1ivz A:8-126 [76863]
    Other proteins in same PDB: d1ivza2, d1ivza3
    structural genomics

Details for d1ivza1

PDB Entry: 1ivz (more details)

PDB Description: Solution structure of the SEA domain from murine hypothetical protein homologous to human mucin 16
PDB Compounds: (A:) hypothetical protein 1110008I14RIK

SCOPe Domain Sequences for d1ivza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivza1 d.58.41.1 (A:8-126) SEA domain from the hypothetical protein homologous to mucin 16 {Mouse (Mus musculus) [TaxId: 10090]}
ssssqhfnlnftitnlpysqdiaqpsttkyqqtkrsienalnqlfrnssiksyfsdcqvl
afrsvsnnnnhtgvdslcnfsplarrvdrvaiyeeflrmthngtqllnftldrksvfvd

SCOPe Domain Coordinates for d1ivza1:

Click to download the PDB-style file with coordinates for d1ivza1.
(The format of our PDB-style files is described here.)

Timeline for d1ivza1: