Lineage for d1ivza_ (1ivz A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1911473Superfamily d.58.41: SEA domain [82671] (1 family) (S)
    automatically mapped to Pfam PF01390
  5. 1911474Family d.58.41.1: SEA domain [82672] (1 protein)
  6. 1911475Protein SEA domain from the hypothetical protein homologous to mucin 16 [82673] (1 species)
  7. 1911476Species Mouse (Mus musculus) [TaxId:10090] [82674] (1 PDB entry)
  8. 1911477Domain d1ivza_: 1ivz A: [76863]
    structural genomics

Details for d1ivza_

PDB Entry: 1ivz (more details)

PDB Description: Solution structure of the SEA domain from murine hypothetical protein homologous to human mucin 16
PDB Compounds: (A:) hypothetical protein 1110008I14RIK

SCOPe Domain Sequences for d1ivza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivza_ d.58.41.1 (A:) SEA domain from the hypothetical protein homologous to mucin 16 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgssssqhfnlnftitnlpysqdiaqpsttkyqqtkrsienalnqlfrnssiksy
fsdcqvlafrsvsnnnnhtgvdslcnfsplarrvdrvaiyeeflrmthngtqllnftldr
ksvfvdsgpssg

SCOPe Domain Coordinates for d1ivza_:

Click to download the PDB-style file with coordinates for d1ivza_.
(The format of our PDB-style files is described here.)

Timeline for d1ivza_: