Lineage for d1ivza_ (1ivz A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 258298Superfamily d.58.41: SEA domain [82671] (1 family) (S)
  5. 258299Family d.58.41.1: SEA domain [82672] (1 protein)
  6. 258300Protein SEA domain from the hypothetical protein homologous to mucin 16 [82673] (1 species)
  7. 258301Species Mouse (Mus musculus) [TaxId:10090] [82674] (1 PDB entry)
  8. 258302Domain d1ivza_: 1ivz A: [76863]
    structural genomics protein

Details for d1ivza_

PDB Entry: 1ivz (more details)

PDB Description: Solution structure of the SEA domain from murine hypothetical protein homologous to human mucin 16
PDB Compounds: (A:)

SCOP Domain Sequences for d1ivza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivza_ d.58.41.1 (A:) SEA domain from the hypothetical protein homologous to mucin 16 {Mouse (Mus musculus)}
gssgssgssssqhfnlnftitnlpysqdiaqpsttkyqqtkrsienalnqlfrnssiksy
fsdcqvlafrsvsnnnnhtgvdslcnfsplarrvdrvaiyeeflrmthngtqllnftldr
ksvfvdsgpssg

SCOP Domain Coordinates for d1ivza_:

Click to download the PDB-style file with coordinates for d1ivza_.
(The format of our PDB-style files is described here.)

Timeline for d1ivza_: