![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily) core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel |
![]() | Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) ![]() |
![]() | Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (3 proteins) inserted into the catalytic domain |
![]() | Protein Valyl-tRNA synthetase (ValRS) [50682] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [50683] (2 PDB entries) |
![]() | Domain d1ivsb3: 1ivs B:190-342 [76861] Other proteins in same PDB: d1ivsa1, d1ivsa2, d1ivsa4, d1ivsb1, d1ivsb2, d1ivsb4 complexed with vaa |
PDB Entry: 1ivs (more details), 2.9 Å
SCOP Domain Sequences for d1ivsb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ivsb3 b.51.1.1 (B:190-342) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus} teptpgklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkrariplte vwipiladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpeal rgldrfearrkavelfreaghlvkeedytiala
Timeline for d1ivsb3:
![]() Domains from other chains: (mouse over for more information) d1ivsa1, d1ivsa2, d1ivsa3, d1ivsa4 |