Lineage for d1ivsa4 (1ivs A:1-189,A:343-578)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590101Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1590321Protein Valyl-tRNA synthetase (ValRS) [52390] (1 species)
  7. 1590322Species Thermus thermophilus [TaxId:274] [52391] (3 PDB entries)
  8. 1590323Domain d1ivsa4: 1ivs A:1-189,A:343-578 [76858]
    Other proteins in same PDB: d1ivsa1, d1ivsa2, d1ivsa3, d1ivsb1, d1ivsb2, d1ivsb3
    protein/RNA complex; complexed with vaa

Details for d1ivsa4

PDB Entry: 1ivs (more details), 2.9 Å

PDB Description: crystal structure of thermus thermophilus valyl-trna synthetase complexed with trna(val) and valyl-adenylate analogue
PDB Compounds: (A:) valyl-tRNA synthetase

SCOPe Domain Sequences for d1ivsa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]}
mdlpkaydpksvepkwaekwaknpfvanpksgkppfvifmpppnvtgslhmghaldnslq
dalirykrmrgfeavwlpgtdhagiatqvvverlllkegktrhdlgrekflervwqwkee
sggtilkqlkrlgasadwsreaftmdekrsravryafsryyheglayraprlvnwcprce
ttlsdleveXtcsrcgtpieyaifpqwwlrmrplaeevlkglrrgdiafvperwkkvnmd
wlenvkdwnisrqlwwghqipawycedcqavnvprperyledptsceacgsprlkrdedv
fdtwfssalwplstlgwpeetedlkafypgdvlvtgydilflwvsrmevsgyhfmgerpf
ktvllhglvldekgqkmskskgnvidplemverygadalrfaliylatggqdirldlrwl
emarnf

SCOPe Domain Coordinates for d1ivsa4:

Click to download the PDB-style file with coordinates for d1ivsa4.
(The format of our PDB-style files is described here.)

Timeline for d1ivsa4: