Lineage for d1ivsa2 (1ivs A:579-796)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 212677Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 212678Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) (S)
  5. 212679Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 212711Protein Valyl-tRNA synthetase (ValRS) [47331] (1 species)
    includes additional alpha+beta (sub)domain at the C-terminus
  7. 212712Species Thermus thermophilus [TaxId:274] [47332] (2 PDB entries)
  8. 212713Domain d1ivsa2: 1ivs A:579-796 [76856]
    Other proteins in same PDB: d1ivsa1, d1ivsa3, d1ivsa4, d1ivsb1, d1ivsb3, d1ivsb4

Details for d1ivsa2

PDB Entry: 1ivs (more details), 2.9 Å

PDB Description: crystal structure of thermus thermophilus valyl-trna synthetase complexed with trna(val) and valyl-adenylate analogue

SCOP Domain Sequences for d1ivsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivsa2 a.27.1.1 (A:579-796) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus}
anklynaarfvllsregfqakedtptladrfmrsrlsrgveeitalyealdlaqaarevy
elvwsefcdwyleaakpalkagnahtlrtleevlavllkllhpmmpfltselyqaltgke
elaleawpepggrdeeaerafealkqavtavralkaeaglppaqevrvylegetapveen
levfrflsradllperpakalvkamprvtarmplegll

SCOP Domain Coordinates for d1ivsa2:

Click to download the PDB-style file with coordinates for d1ivsa2.
(The format of our PDB-style files is described here.)

Timeline for d1ivsa2: