![]() | Class a: All alpha proteins [46456] (171 folds) |
![]() | Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
![]() | Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) ![]() |
![]() | Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins) |
![]() | Protein Valyl-tRNA synthetase (ValRS) [47331] (1 species) includes additional alpha+beta (sub)domain at the C-terminus |
![]() | Species Thermus thermophilus [TaxId:274] [47332] (2 PDB entries) |
![]() | Domain d1ivsa2: 1ivs A:579-796 [76856] Other proteins in same PDB: d1ivsa1, d1ivsa3, d1ivsa4, d1ivsb1, d1ivsb3, d1ivsb4 |
PDB Entry: 1ivs (more details), 2.9 Å
SCOP Domain Sequences for d1ivsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ivsa2 a.27.1.1 (A:579-796) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus} anklynaarfvllsregfqakedtptladrfmrsrlsrgveeitalyealdlaqaarevy elvwsefcdwyleaakpalkagnahtlrtleevlavllkllhpmmpfltselyqaltgke elaleawpepggrdeeaerafealkqavtavralkaeaglppaqevrvylegetapveen levfrflsradllperpakalvkamprvtarmplegll
Timeline for d1ivsa2:
![]() Domains from other chains: (mouse over for more information) d1ivsb1, d1ivsb2, d1ivsb3, d1ivsb4 |