![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.7: tRNA-binding arm [46589] (4 families) ![]() formerly a class II aminoacyl-tRNA synthetase N-domain |
![]() | Family a.2.7.3: Valyl-tRNA synthetase (ValRS) C-terminal domain [81635] (1 protein) |
![]() | Protein Valyl-tRNA synthetase (ValRS) C-terminal domain [81634] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [81633] (3 PDB entries) |
![]() | Domain d1ivsa1: 1ivs A:797-862 [76855] Other proteins in same PDB: d1ivsa2, d1ivsa3, d1ivsa4, d1ivsb2, d1ivsb3, d1ivsb4 protein/RNA complex; complexed with vaa |
PDB Entry: 1ivs (more details), 2.9 Å
SCOPe Domain Sequences for d1ivsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ivsa1 a.2.7.3 (A:797-862) Valyl-tRNA synthetase (ValRS) C-terminal domain {Thermus thermophilus [TaxId: 274]} dveewrrrqekrlkellalaersqrklaspgfrekapkevveaeearlkenleqaerire alsqig
Timeline for d1ivsa1:
![]() Domains from other chains: (mouse over for more information) d1ivsb1, d1ivsb2, d1ivsb3, d1ivsb4 |