Lineage for d1ivod_ (1ivo D:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961206Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1961207Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1961331Protein Epidermal growth factor, EGF [57215] (2 species)
  7. 1961332Species Human (Homo sapiens) [TaxId:9606] [69939] (5 PDB entries)
  8. 1961337Domain d1ivod_: 1ivo D: [76854]
    Other proteins in same PDB: d1ivoa1, d1ivoa2, d1ivoa3, d1ivoa4, d1ivob1, d1ivob2, d1ivob3, d1ivob4
    complexed with EGF receptor
    complexed with nag

Details for d1ivod_

PDB Entry: 1ivo (more details), 3.3 Å

PDB Description: crystal structure of the complex of human epidermal growth factor and receptor extracellular domains.
PDB Compounds: (D:) epidermal growth factor

SCOPe Domain Sequences for d1ivod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivod_ g.3.11.1 (D:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]}
ecplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwe

SCOPe Domain Coordinates for d1ivod_:

Click to download the PDB-style file with coordinates for d1ivod_.
(The format of our PDB-style files is described here.)

Timeline for d1ivod_: