SCOPe 2.04: Domain d1ivod

Root: SCOPe 2.04
Class g: Small proteins [56992] (91 folds)
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
Superfamily g.3.11: EGF/Laminin [57196] (8 families)
Family g.3.11.1: EGF-type module [57197] (23 proteins)
Protein Epidermal growth factor, EGF [57215] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [69939] (5 PDB entries)
Domain d1ivod_: 1ivo D: [76854]
Other proteins in same PDB: d1ivoa1, d1ivoa2, d1ivoa3, d1ivoa4, d1ivob1, d1ivob2, d1ivob3, d1ivob4
complexed with EGF receptor
complexed with nag

PDB Entry: 1ivo (more details), 3.3 Å

PDB Description: crystal structure of the complex of human epidermal growth factor and receptor extracellular domains.

PDB Compounds: (D:) epidermal growth factor

SCOPe Domain Sequences for d1ivod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivod_ g.3.11.1 (D:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]}
ecplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwe

SCOPe Domain Coordinates for d1ivod_:

Click to download the PDB-style file with coordinates for d1ivod_.
(The format of our PDB-style files is described here.)

Timeline for d1ivod_:

Thumbnails for d1ivod_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ivoa1, d1ivoa2, d1ivoa3, d1ivoa4, d1ivob1, d1ivob2, d1ivob3, d1ivob4, d1ivoc_