![]() | Class g: Small proteins [56992] (61 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) disulphide-bound fold; contains beta-hairpin with two adjacent disulphides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (6 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (18 proteins) |
![]() | Protein Epidermal growth factor, EGF [57215] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69939] (2 PDB entries) |
![]() | Domain d1ivod_: 1ivo D: [76854] Other proteins in same PDB: d1ivoa1, d1ivoa2, d1ivoa3, d1ivoa4, d1ivob1, d1ivob2, d1ivob3, d1ivob4 complexed with nag |
PDB Entry: 1ivo (more details), 3.3 Å
SCOP Domain Sequences for d1ivod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ivod_ g.3.11.1 (D:) Epidermal growth factor, EGF {Human (Homo sapiens)} ecplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwe
Timeline for d1ivod_: