Lineage for d1ivod_ (1ivo D:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 268805Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 269314Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 269315Family g.3.11.1: EGF-type module [57197] (18 proteins)
  6. 269362Protein Epidermal growth factor, EGF [57215] (2 species)
  7. 269363Species Human (Homo sapiens) [TaxId:9606] [69939] (2 PDB entries)
  8. 269367Domain d1ivod_: 1ivo D: [76854]
    Other proteins in same PDB: d1ivoa1, d1ivoa2, d1ivoa3, d1ivoa4, d1ivob1, d1ivob2, d1ivob3, d1ivob4
    complexed with nag

Details for d1ivod_

PDB Entry: 1ivo (more details), 3.3 Å

PDB Description: crystal structure of the complex of human epidermal growth factor and receptor extracellular domains.

SCOP Domain Sequences for d1ivod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivod_ g.3.11.1 (D:) Epidermal growth factor, EGF {Human (Homo sapiens)}
ecplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwe

SCOP Domain Coordinates for d1ivod_:

Click to download the PDB-style file with coordinates for d1ivod_.
(The format of our PDB-style files is described here.)

Timeline for d1ivod_: