SCOP 1.63: Domain d1ivob3: 1ivo B:163-311

Lineage for d1ivob3 (1ivo B:163-311)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
   disulphide-bound fold; contains beta-hairpin with two adjacent disulphides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (1 family)

5. Family g.3.9.1: Growth factor receptor domain [57185] (5 proteins)

6. Protein EGF receptor Cys-rich domains [82887] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82888] (1 PDB entry)

8. Domain d1ivob3: 1ivo B:163-311 [76851]
   Other proteins in same PDB: d1ivoa1, d1ivoa2, d1ivob1, d1ivob2, d1ivoc_, d1ivod_

Details for d1ivob3

PDB Entry: 1ivo, 3.3 Å

PDB Description: crystal structure of the complex of human epidermal growth factor and receptor extracellular domains.

SCOP Domain Sequences for d1ivob3:

Sequence; same for both SEQRES and ATOM records:

>d1ivob3 g.3.9.1 (B:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens)}
cqkcdpscpngscwgageencqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpres
dclvcrkfrdeatckdtcpplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgs
cvracgadsyemeedgvrkckkcegpcrk

Timeline for d1ivob3:

• d1ivob3 is new in SCOP 1.63
  
• d1ivob3 appears in SCOP 1.65
  
• d1ivob3 appears in the current release, SCOPe 2.07