Lineage for d1ivoa3 (1ivo A:163-311)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961098Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 1961099Family g.3.9.1: Growth factor receptor domain [57185] (9 proteins)
  6. 1961100Protein EGF receptor Cys-rich domains [82887] (1 species)
  7. 1961101Species Human (Homo sapiens) [TaxId:9606] [82888] (6 PDB entries)
  8. 1961113Domain d1ivoa3: 1ivo A:163-311 [76847]
    Other proteins in same PDB: d1ivoa1, d1ivoa2, d1ivob1, d1ivob2, d1ivoc_, d1ivod_
    complexed with EGF
    complexed with nag

Details for d1ivoa3

PDB Entry: 1ivo (more details), 3.3 Å

PDB Description: crystal structure of the complex of human epidermal growth factor and receptor extracellular domains.
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d1ivoa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivoa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]}
cqkcdpscpngscwgageencqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpres
dclvcrkfrdeatckdtcpplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgs
cvracgadsyemeedgvrkckkcegpcrk

SCOPe Domain Coordinates for d1ivoa3:

Click to download the PDB-style file with coordinates for d1ivoa3.
(The format of our PDB-style files is described here.)

Timeline for d1ivoa3: