Lineage for d1ivoa3 (1ivo A:163-311)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 268805Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
    disulphide-bound fold; contains beta-hairpin with two adjacent disulphides
  4. 269264Superfamily g.3.9: Growth factor receptor domain [57184] (1 family) (S)
  5. 269265Family g.3.9.1: Growth factor receptor domain [57185] (5 proteins)
  6. 269266Protein EGF receptor Cys-rich domains [82887] (1 species)
  7. 269267Species Human (Homo sapiens) [TaxId:9606] [82888] (1 PDB entry)
  8. 269268Domain d1ivoa3: 1ivo A:163-311 [76847]
    Other proteins in same PDB: d1ivoa1, d1ivoa2, d1ivob1, d1ivob2, d1ivoc_, d1ivod_

Details for d1ivoa3

PDB Entry: 1ivo (more details), 3.3 Å

PDB Description: Crystal Structure of the Complex of Human Epidermal Growth Factor and Receptor Extracellular Domains.

SCOP Domain Sequences for d1ivoa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivoa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens)}
cqkcdpscpngscwgageencqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpres
dclvcrkfrdeatckdtcpplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgs
cvracgadsyemeedgvrkckkcegpcrk

SCOP Domain Coordinates for d1ivoa3:

Click to download the PDB-style file with coordinates for d1ivoa3.
(The format of our PDB-style files is described here.)

Timeline for d1ivoa3: