![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N |
![]() | Superfamily c.10.2: L domain-like [52058] (7 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.5: L domain [52071] (4 proteins) |
![]() | Protein EGF receptor extracellular domain [82326] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82327] (1 PDB entry) |
![]() | Domain d1ivoa1: 1ivo A:2-162 [76845] Other proteins in same PDB: d1ivoa3, d1ivoa4, d1ivob3, d1ivob4, d1ivoc_, d1ivod_ |
PDB Entry: 1ivo (more details), 3.3 Å
SCOP Domain Sequences for d1ivoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ivoa1 c.10.2.5 (A:2-162) EGF receptor extracellular domain {Human (Homo sapiens)} eekkvcqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqev agyvlialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmrnlqeilh gavrfsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgs
Timeline for d1ivoa1: