SCOPe 2.05: Domain d1ivja_: 1ivj A:

Lineage for d1ivja_ (1ivj A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48617] (25 PDB entries)
   Uniprot P06762 11-222

8. Domain d1ivja_: 1ivj A: [76844]
   complexed with azi, hem

Details for d1ivja_

PDB Entry: 1ivj, 1.9 Å

PDB Description: Crystal Structure of Rat Hemeoxygenase-1 in Complex with Heme and Azide.

PDB Compounds: (A:) Hemeoxygenase-1

SCOPe Domain Sequences for d1ivja_:

Sequence; same for both SEQRES and ATOM records:

>d1ivja_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq
npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv
ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle
mtpevkhrvteeaktafllnielfeelqallt

Timeline for d1ivja_:

• d1ivja_ first appeared in SCOP 1.63
  
• d1ivja_ appears in SCOPe 2.04
  
• d1ivja_ appears in SCOPe 2.06
  
• d1ivja_ appears in the current release, SCOPe 2.08