SCOP 1.73: Domain d1iv8a1: 1iv8 A:654-720

Lineage for d1iv8a1 (1iv8 A:654-720)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltooligosyl trehalose synthase [82177] (1 species)

7. Species Archaeon Sulfolobus acidocaldarius [TaxId:2285] [82178] (1 PDB entry)

8. Domain d1iv8a1: 1iv8 A:654-720 [76842]
   Other proteins in same PDB: d1iv8a2
   complexed with mly, mlz

Details for d1iv8a1

PDB Entry: 1iv8, 1.9 Å

PDB Description: Crystal Structure of Maltooligosyl trehalose synthase

PDB Compounds: (A:) maltooligosyl trehalose synthase

SCOP Domain Sequences for d1iv8a1:

Sequence; same for both SEQRES and ATOM records:

>d1iv8a1 b.71.1.1 (A:654-720) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}
eykgldleeglcgfirfnkilviiktkgsvnyklkleegaiytdvltgeeikkevqinel
prilvrm

Timeline for d1iv8a1:

• d1iv8a1 first appeared in SCOP 1.63
  
• d1iv8a1 appears in SCOP 1.71
  
• d1iv8a1 appears in SCOP 1.75
  
• d1iv8a1 appears in the current release, SCOPe 2.08