Lineage for d1iv5b1 (1iv5 B:213-301)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346610Fold a.135: Tetraspanin [48651] (1 superfamily)
    5 helices: irregular disulfide-linked array; form homodimer
  4. 2346611Superfamily a.135.1: Tetraspanin [48652] (1 family) (S)
  5. 2346612Family a.135.1.1: Tetraspanin [48653] (2 proteins)
  6. 2346613Protein CD81 extracellular domain [48654] (1 species)
  7. 2346614Species Human (Homo sapiens) [TaxId:9606] [48655] (2 PDB entries)
  8. 2346618Domain d1iv5b1: 1iv5 B:213-301 [76841]
    Other proteins in same PDB: d1iv5a2, d1iv5b2

Details for d1iv5b1

PDB Entry: 1iv5 (more details), 2.6 Å

PDB Description: New Crystal Form of Human CD81 Large Extracellular Loop.
PDB Compounds: (B:) CD81 antigen

SCOPe Domain Sequences for d1iv5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iv5b1 a.135.1.1 (B:213-301) CD81 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
nlcpsgsniisnlfkedchqkiddlfsgk

SCOPe Domain Coordinates for d1iv5b1:

Click to download the PDB-style file with coordinates for d1iv5b1.
(The format of our PDB-style files is described here.)

Timeline for d1iv5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iv5b2