SCOP 1.69: Domain d1iv3d_: 1iv3 D:

Lineage for d1iv3d_ (1iv3 D:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69765] (1 family)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69766] (1 protein)

6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (3 species)

7. Species Thermus thermophilus [TaxId:274] [82720] (4 PDB entries)

8. Domain d1iv3d_: 1iv3 D: [76831]

Details for d1iv3d_

PDB Entry: 1iv3, 1.52 Å

PDB Description: structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (bound form mg atoms)

SCOP Domain Sequences for d1iv3d_:

Sequence; same for both SEQRES and ATOM records:

>d1iv3d_ d.79.5.1 (D:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Thermus thermophilus}
rigygedshrleegrplylcgllipspvgalahsdgdaamhaltdallsayglgdigllf
pdtdprwrgersevflreamrlveargakllqaslvltldrpklgphrkalvdslsrlmr
lpqdrigltfktseglapshvqaravvlld

Timeline for d1iv3d_:

• d1iv3d_ first appeared in SCOP 1.63
  
• d1iv3d_ appears in SCOP 1.67
  
• d1iv3d_ appears in SCOP 1.71
  
• d1iv3d_ appears in the current release, SCOPe 2.08