Lineage for d1iv2b_ (1iv2 B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506461Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 506680Superfamily d.79.5: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69765] (1 family) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 506681Family d.79.5.1: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69766] (1 protein)
  6. 506682Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (3 species)
  7. 506710Species Thermus thermophilus [TaxId:274] [82720] (4 PDB entries)
  8. 506718Domain d1iv2b_: 1iv2 B: [76823]

Details for d1iv2b_

PDB Entry: 1iv2 (more details), 1.55 Å

PDB Description: structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (bound form cdp)

SCOP Domain Sequences for d1iv2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iv2b_ d.79.5.1 (B:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Thermus thermophilus}
rigygedshrleegrplylcgllipspvgalahsdgdaamhaltdallsayglgdigllf
pdtdprwrgersevflreamrlveargakllqaslvltldrpklgphrkalvdslsrlmr
lpqdrigltfktseglapshvqaravvlld

SCOP Domain Coordinates for d1iv2b_:

Click to download the PDB-style file with coordinates for d1iv2b_.
(The format of our PDB-style files is described here.)

Timeline for d1iv2b_: