SCOPe 2.04: Domain d1iv1a_: 1iv1 A:

Lineage for d1iv1a_ (1iv1 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (3 proteins)
   automatically mapped to Pfam PF02542

6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)

7. Species Thermus thermophilus [TaxId:274] [82720] (4 PDB entries)

8. Domain d1iv1a_: 1iv1 A: [76816]

Details for d1iv1a_

PDB Entry: 1iv1, 1.65 Å

PDB Description: Structure of 2C-Methyl-D-erythritol-2,4-cyclodiphosphate Synthase

PDB Compounds: (A:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d1iv1a_:

Sequence; same for both SEQRES and ATOM records:

>d1iv1a_ d.79.5.1 (A:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Thermus thermophilus [TaxId: 274]}
rigygedshrleegrplylcgllipspvgalahsdgdaalhaltdallsayglgdigllf
pdtdprwrgersevflrealrlveargakllqaslvltldrpklgphrkalvdslsrllr
lpqdrigltfktseglapshvqaravvlld

Timeline for d1iv1a_:

• d1iv1a_ first appeared in SCOP 1.63
  
• d1iv1a_ appears in SCOPe 2.03
  
• d1iv1a_ appears in SCOPe 2.05
  
• d1iv1a_ appears in the current release, SCOPe 2.08