Lineage for d1iupa_ (1iup A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900404Family c.69.1.10: Carbon-carbon bond hydrolase [53522] (3 proteins)
    closely related to the Proline iminopeptidase-like family
  6. 2900428Protein Meta-cleavage product hydrolase CumD [82507] (1 species)
    2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
  7. 2900429Species Pseudomonas fluorescens [TaxId:294] [82508] (10 PDB entries)
    Uniprot P96965 3-273
  8. 2900431Domain d1iupa_: 1iup A: [76815]
    complexed with alq; mutant

Details for d1iupa_

PDB Entry: 1iup (more details), 1.6 Å

PDB Description: meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with isobutyrates
PDB Compounds: (A:) meta-Cleavage product hydrolase

SCOPe Domain Sequences for d1iupa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iupa_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]}
nleigksilaagvltnyhdvgegqpvilihgsgpgvsayanwrltipalskfyrviapdm
vgfgftdrpenynyskdswvdhiigimdaleiekahivgnafggglaiatalryservdr
mvlmgaagtrfdvteglnavwgytpsienmrnlldifaydrslvtdelarlryeasiqpg
fqesfssmfpeprqrwidalassdediktlpnetliihgredqvvplssslrlgelidra
qlhvfgrcghwtqieqtdrfnrlvveffnea

SCOPe Domain Coordinates for d1iupa_:

Click to download the PDB-style file with coordinates for d1iupa_.
(The format of our PDB-style files is described here.)

Timeline for d1iupa_: