SCOPe 2.08: Domain d1iunb_: 1iun B:

Lineage for d1iunb_ (1iun B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.10: Carbon-carbon bond hydrolase [53522] (3 proteins)
   closely related to the Proline iminopeptidase-like family

6. Protein Meta-cleavage product hydrolase CumD [82507] (1 species)
   2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase

7. Species Pseudomonas fluorescens [TaxId:294] [82508] (10 PDB entries)
   Uniprot P96965 3-273

8. Domain d1iunb_: 1iun B: [76813]
   complexed with act; mutant

Details for d1iunb_

PDB Entry: 1iun, 2.8 Å

PDB Description: meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal

PDB Compounds: (B:) meta-Cleavage product hydrolase

SCOPe Domain Sequences for d1iunb_:

Sequence; same for both SEQRES and ATOM records:

>d1iunb_ c.69.1.10 (B:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]}
anleigksilaagvltnyhdvgegqpvilihgsgpgvsayanwrltipalskfyrviapd
mvgfgftdrpenynyskdswvdhiigimdaleiekahivgnafggglaiatalryservd
rmvlmgaagtrfdvteglnavwgytpsienmrnlldifaydrslvtdelarlryeasiqp
gfqesfssmfpeprqrwidalassdediktlpnetliihgredqvvplssslrlgelidr
aqlhvfgrcghwtqieqtdrfnrlvveffneantpk

Timeline for d1iunb_:

• d1iunb_ first appeared in SCOP 1.63
  
• d1iunb_ appears in SCOPe 2.07