Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) both pyridine (Pyr)- and pyrophosphate (PP)-binding modules have this fold conserved core consists of two Pyr and two PP-modules and binds two coenzyme molecules |
Family c.36.1.2: TK-like THDP-binding domains [52528] (2 proteins) different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain |
Protein Transketolase (TK), PP and Pyr modules [52529] (2 species) |
Species Maize (Zea mays) [TaxId:4577] [82392] (1 PDB entry) |
Domain d1itzc2: 1itz C:348-539 [76804] Other proteins in same PDB: d1itza3, d1itzb3, d1itzc3 complexed with mg, tpp |
PDB Entry: 1itz (more details), 2.3 Å
SCOP Domain Sequences for d1itzc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1itzc2 c.36.1.2 (C:348-539) Transketolase (TK), PP and Pyr modules {Maize (Zea mays)} lptgwvdalpkytpespgdatrnlsqqclnalanvvpgliggsadlassnmtllkmfgdf qkdtaeernvrfgvrehgmgaicngialhspgfvpycatffvftdymrgamrisalseag viyvmthdsiglgedgpthqpiehlvsframpnilmlrpadgnetagaykvavlnrkrps ilalsrqklphl
Timeline for d1itzc2: