SCOPe 2.05: Domain d1itzb1: 1itz B:10-347

Lineage for d1itzb1 (1itz B:10-347)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.10: TK-like PP module [88760] (3 proteins)
   different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain

6. Protein Transketolase (TK), PP module [88761] (4 species)

7. Species Maize (Zea mays) [TaxId:4577] [88763] (1 PDB entry)

8. Domain d1itzb1: 1itz B:10-347 [76800]
   Other proteins in same PDB: d1itza2, d1itza3, d1itzb2, d1itzb3, d1itzc2, d1itzc3
   complexed with mg, tpp

Details for d1itzb1

PDB Entry: 1itz, 2.3 Å

PDB Description: Maize Transketolase in complex with TPP

PDB Compounds: (B:) transketolase

SCOPe Domain Sequences for d1itzb1:

Sequence; same for both SEQRES and ATOM records:

>d1itzb1 c.36.1.10 (B:10-347) Transketolase (TK), PP module {Maize (Zea mays) [TaxId: 4577]}
aatgelleksvntirflaidavekansghpglpmgcapmghvlydevmrynpknpywfnr
drfvlsaghgcmlqyallhlagydsvkeedlkqfrqwgsrtpghpenfetpgvevttgpl
gqgianavglalaekhlaarfnkpdseivdhytyvilgdgcqmegianeacslaghwglg
kliafyddnhisidgdteiaftedvstrfealgwhtiwvkngntgyddiraaikeakavt
dkptlikvtttigfgspnkansysvhgsalgakeveatrqnlgwpydtffvpedvkshws
rhtpegaaleadwnakfaeyekkyaddaatlksiitge

Timeline for d1itzb1:

• d1itzb1 first appeared in SCOP 1.63
  
• d1itzb1 appears in SCOPe 2.04
  
• d1itzb1 appears in SCOPe 2.06
  
• d1itzb1 appears in the current release, SCOPe 2.08