![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
![]() | Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) ![]() |
![]() | Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins) |
![]() | Protein Transketolase (TK), C-domain [52924] (3 species) two N-terminal domains are PP and Pyr modules of thiamin-binding fold |
![]() | Species Maize (Zea mays) [TaxId:4577] [82430] (1 PDB entry) |
![]() | Domain d1itza3: 1itz A:540-675 [76799] Other proteins in same PDB: d1itza1, d1itza2, d1itzb1, d1itzb2, d1itzc1, d1itzc2 |
PDB Entry: 1itz (more details), 2.3 Å
SCOP Domain Sequences for d1itza3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1itza3 c.48.1.1 (A:540-675) Transketolase (TK), C-domain {Maize (Zea mays)} pgtsiegvekggytisdnstgnkpdlivmgtgseleiaakaadelrkegktvrvvsfvsw elfdeqsdeykesvlpaavtarisieagstlgwqkyvgaqgkaigidkfgasapagtiyk eygitvesiiaaaksf
Timeline for d1itza3: