Lineage for d1itwd_ (1itw D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138891Family c.77.1.2: Monomeric isocitrate dehydrogenase [82526] (2 protein domains)
    the active site is contained within one subunit between the canonical ICDH fold and a large insert domain that itself is a probable rudiment form of ICDH fold resulted from duplication, domain swapping and deletion
    automatically mapped to Pfam PF03971
  6. 2138892Protein Monomeric isocitrate dehydrogenase [82527] (1 species)
  7. 2138893Species Azotobacter vinelandii [TaxId:354] [82528] (1 PDB entry)
    the insert region spans residues 150-404
  8. 2138897Domain d1itwd_: 1itw D: [76796]
    complexed with ict, mn

Details for d1itwd_

PDB Entry: 1itw (more details), 1.95 Å

PDB Description: crystal structure of the monomeric isocitrate dehydrogenase in complex with isocitrate and mn
PDB Compounds: (D:) isocitrate dehydrogenase

SCOPe Domain Sequences for d1itwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itwd_ c.77.1.2 (D:) Monomeric isocitrate dehydrogenase {Azotobacter vinelandii [TaxId: 354]}
stpkiiytltdeapalatysllpiikaftgssgiavetrdislagrliatfpeyltdtqk
isddlaelgklattpdaniiklpnisasvpqlkaaikelqqqgyklpdypeepktdtekd
vkarydkikgsavnpvlregnsdrraplsvknyarkhphkmgawsadskshvahmdngdf
ygsekaaligapgsvkieliakdgsstvlkaktsvqageiidssvmsknalrnfiaaeie
dakkqgvllsvhlkatmmkvsdpimfgqivsefykdaltkhaevlkqigfdvnngigdly
ariktlpeakqkeieadiqavyaqrpqlamvnsdkgitnlhvpsdvivdasmpamirdsg
kmwgpdgklhdtkavipdrcyagvyqvviedckqhgafdpttmgsvpnvglmaqkaeeyg
shdktfqipadgvvrvtdesgkllleqsveagdiwrmcqakdapiqdwvklavnraratn
tpavfwldparahdaqviakverylkdydtsgldirilspveatrfslariregkdtisv
tgnvlrdyltdlfpimelgtsakmlsivplmsggglfetgaggsapkhvqqfleegylrw
dslgeflalaaslehlgnayknpkalvlastldqatgkildnnksparkvgeidnrgshf
ylalywaqalaaqtedkelqaqftgiakaltdnetkivgelaaaqgkpvdiagyyhpntd
ltskamrpsatfnaalapla

SCOPe Domain Coordinates for d1itwd_:

Click to download the PDB-style file with coordinates for d1itwd_.
(The format of our PDB-style files is described here.)

Timeline for d1itwd_: