SCOPe 2.05: Domain d1itva_: 1itv A:

Lineage for d1itva_ (1itv A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
   consists of four 4-stranded beta-sheet motifs; meander

4. Superfamily b.66.1: Hemopexin-like domain [50923] (2 families)

5. Family b.66.1.1: Hemopexin-like domain [50924] (6 proteins)

6. Protein Gelatinase B (MMP-9) [82162] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82163] (1 PDB entry)

8. Domain d1itva_: 1itv A: [76791]
   complexed with so4

Details for d1itva_

PDB Entry: 1itv, 1.95 Å

PDB Description: Dimeric form of the haemopexin domain of MMP9

PDB Compounds: (A:) mmp9

SCOPe Domain Sequences for d1itva_:

Sequence; same for both SEQRES and ATOM records:

>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
ddacnvnifdaiaeignqlylfkdgkywrfsegrgsrpqgpfliadkwpalprkldsvfe
eplskklfffsgrqvwvytgasvlgprrldklglgadvaqvtgalrsgrgkmllfsgrrl
wrfdvkaqmvdprsasevdrmfpgvpldthdvfqfrekayfcqdrfywrvssrselnqvd
qvgyvtydilqcped

Timeline for d1itva_:

• d1itva_ first appeared in SCOP 1.63
  
• d1itva_ appears in SCOPe 2.04
  
• d1itva_ appears in SCOPe 2.06
  
• d1itva_ appears in the current release, SCOPe 2.08