SCOPe 2.07: Domain d1it9l2: 1it9 L:112-214

Lineage for d1it9l2 (1it9 L:112-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (151 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1it9l2: 1it9 L:112-214 [76786]
   Other proteins in same PDB: d1it9h1, d1it9h2, d1it9l1
   part of humanized anti-human Fas Fab HFE7A

Details for d1it9l2

PDB Entry: 1it9, 2.8 Å

PDB Description: crystal structure of an antigen-binding fragment from a humanized version of the anti-human fas antibody hfe7a

PDB Compounds: (L:) humanized antibody hfe7a, light chain

SCOPe Domain Sequences for d1it9l2:

Sequence; same for both SEQRES and ATOM records:

>d1it9l2 b.1.1.2 (L:112-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfn

Timeline for d1it9l2:

• d1it9l2 first appeared in SCOP 1.63
  
• d1it9l2 appears in SCOPe 2.06
  
• d1it9l2 appears in the current release, SCOPe 2.08