![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88569] (62 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
![]() | Domain d1it9l2: 1it9 L:112-214 [76786] Other proteins in same PDB: d1it9h1, d1it9h2, d1it9l1 part of humanized anti-human Fas Fab HFE7A |
PDB Entry: 1it9 (more details), 2.8 Å
SCOP Domain Sequences for d1it9l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1it9l2 b.1.1.2 (L:112-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfn
Timeline for d1it9l2: