Lineage for d1it9l2 (1it9 L:112-214)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289616Species Human (Homo sapiens) [TaxId:9606] [88569] (62 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 289689Domain d1it9l2: 1it9 L:112-214 [76786]
    Other proteins in same PDB: d1it9h1, d1it9h2, d1it9l1
    part of humanized anti-human Fas Fab HFE7A

Details for d1it9l2

PDB Entry: 1it9 (more details), 2.8 Å

PDB Description: crystal structure of an antigen-binding fragment from a humanized version of the anti-human fas antibody hfe7a

SCOP Domain Sequences for d1it9l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it9l2 b.1.1.2 (L:112-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfn

SCOP Domain Coordinates for d1it9l2:

Click to download the PDB-style file with coordinates for d1it9l2.
(The format of our PDB-style files is described here.)

Timeline for d1it9l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1it9l1