Lineage for d1it9l1 (1it9 L:1-111)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219088Species Anti-human Fas Fab HFE7A, (humanized), kappa L chain [81948] (1 PDB entry)
  8. 219090Domain d1it9l1: 1it9 L:1-111 [76785]
    Other proteins in same PDB: d1it9h2, d1it9l2

Details for d1it9l1

PDB Entry: 1it9 (more details), 2.8 Å

PDB Description: crystal structure of an antigen-binding fragment from a humanized version of the anti-human fas antibody hfe7a

SCOP Domain Sequences for d1it9l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it9l1 b.1.1.1 (L:1-111) Immunoglobulin (variable domains of L and H chains) {Anti-human Fas Fab HFE7A, (humanized), kappa L chain}
eivltqspgtlslspgeratlsckasqsvdydgdsymnwyqqkpgqaprlliyaasnles
gipdrfsgsgsgtdftltisrlepedfavyycqqsnedprtfgqgtkleik

SCOP Domain Coordinates for d1it9l1:

Click to download the PDB-style file with coordinates for d1it9l1.
(The format of our PDB-style files is described here.)

Timeline for d1it9l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1it9l2