Lineage for d1it9h2 (1it9 H:122-219)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365023Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 365109Domain d1it9h2: 1it9 H:122-219 [76784]
    Other proteins in same PDB: d1it9h1, d1it9l1, d1it9l2
    part of humanized anti-human Fas Fab HFE7A

Details for d1it9h2

PDB Entry: 1it9 (more details), 2.8 Å

PDB Description: crystal structure of an antigen-binding fragment from a humanized version of the anti-human fas antibody hfe7a

SCOP Domain Sequences for d1it9h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it9h2 b.1.1.2 (H:122-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv

SCOP Domain Coordinates for d1it9h2:

Click to download the PDB-style file with coordinates for d1it9h2.
(The format of our PDB-style files is described here.)

Timeline for d1it9h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1it9h1