SCOP 1.63: Domain d1it9h2: 1it9 H:122-219

Lineage for d1it9h2 (1it9 H:122-219)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Anti-human Fas Fab HFE7A, (humanized), kappa L chain [81954] (1 PDB entry)

8. Domain d1it9h2: 1it9 H:122-219 [76784]
   Other proteins in same PDB: d1it9h1, d1it9l1

Details for d1it9h2

PDB Entry: 1it9, 2.8 Å

PDB Description: crystal structure of an antigen-binding fragment from a humanized version of the anti-human fas antibody hfe7a

SCOP Domain Sequences for d1it9h2:

Sequence; same for both SEQRES and ATOM records:

>d1it9h2 b.1.1.2 (H:122-219) Immunoglobulin (constant domains of L and H chains) {Anti-human Fas Fab HFE7A, (humanized), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv

Timeline for d1it9h2:

• d1it9h2 is new in SCOP 1.63
  
• d1it9h2 appears in SCOP 1.65
  
• d1it9h2 appears in the current release, SCOPe 2.08